PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G188900.1
Common NamePHAVU_006G188900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family NAC
Protein Properties Length: 356aa    MW: 39702.4 Da    PI: 9.1594
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G188900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.11.7e-53181451128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelvv+yLk+k+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+d++
  Phvul.006G188900.1  18 LPPGFRFHPTDEELVVHYLKRKADSVPLPV-AIIAEVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGARPNRAASSGYWKATGTDRP 107
                         79****************************.88***************8888999************************************ PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +l++ ++++vg+kk Lvfy g+ pkg+kt+W+mheyrl
  Phvul.006G188900.1 108 ILAShGHHKVGVKKALVFYGGKPPKGVKTNWIMHEYRL 145
                         **9867788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.22E-6411185IPR003441NAC domain
PROSITE profilePS5100561.42118185IPR003441NAC domain
PfamPF023657.6E-2819145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MNSMGSSSEY HTHQHPHLPP GFRFHPTDEE LVVHYLKRKA DSVPLPVAII AEVDLYKFDP  60
WELPSKATFG EQEWYFFSPR DRKYPNGARP NRAASSGYWK ATGTDRPILA SHGHHKVGVK  120
KALVFYGGKP PKGVKTNWIM HEYRLISTSS NSTSKPPSLP ADHARSTKKN SLRLDDWVLC  180
RIYKKNNSTI MPRFPLMEQN KELSSESTMV PMMSTLSMAN NNTTQNSKAG TSTSASYGPL  240
GLENDDNLFD GILGVDHSMQ QDVSDSHQVS SKGIYPVKRA LSSQFWNDTG SSSSSRRFHC  300
DLNAGSNTVE EDNSFVSMLS QLPQNTGFHP NALLGPVSND VLRQQFQLPS MNWNV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-7441881171Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007148205.10.0hypothetical protein PHAVU_006G188900g
SwissprotQ8GY421e-116NAC25_ARATH; NAC transcription factor 25
TrEMBLV7BQG40.0V7BQG4_PHAVU; Uncharacterized protein
STRINGGLYMA15G07620.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-111NAC domain containing protein 25